| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) ![]() automatically mapped to Pfam PF02511 |
| Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
| Protein Thy1 homologue [69798] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [69799] (28 PDB entries) TM0449 |
| Domain d3n0bb_: 3n0b B: [181744] Other proteins in same PDB: d3n0ba2 automated match to d1kq4b_ complexed with fad, ump; mutant |
PDB Entry: 3n0b (more details), 2.3 Å
SCOPe Domain Sequences for d3n0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0bb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
Timeline for d3n0bb_:
View in 3DDomains from other chains: (mouse over for more information) d3n0ba1, d3n0ba2, d3n0bc_, d3n0bd_ |