Lineage for d3n0bb_ (3n0b B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238756Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 2238757Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 2238758Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 2238759Protein Thy1 homologue [69798] (1 species)
  7. 2238760Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries)
    TM0449
  8. 2238818Domain d3n0bb_: 3n0b B: [181744]
    Other proteins in same PDB: d3n0ba2
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3n0bb_

PDB Entry: 3n0b (more details), 2.3 Å

PDB Description: tm0449 mutant crystals grown in loops/micromounts
PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3n0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0bb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOPe Domain Coordinates for d3n0bb_:

Click to download the PDB-style file with coordinates for d3n0bb_.
(The format of our PDB-style files is described here.)

Timeline for d3n0bb_: