Lineage for d1bc1__ (1bc1 -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539977Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 539978Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 539979Family a.65.1.1: Annexin [47875] (9 proteins)
  6. 540005Protein Annexin V [47883] (3 species)
  7. 540024Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)
  8. 540032Domain d1bc1__: 1bc1 - [18173]
    complexed with ca, so4; mutant

Details for d1bc1__

PDB Entry: 1bc1 (more details), 2.05 Å

PDB Description: recombinant rat annexin v, quadruple mutant (t72k, s144k, s228k, s303k)

SCOP Domain Sequences for d1bc1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc1__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkselkgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtkgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretkgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tkgdykkallllcggedd

SCOP Domain Coordinates for d1bc1__:

Click to download the PDB-style file with coordinates for d1bc1__.
(The format of our PDB-style files is described here.)

Timeline for d1bc1__: