SCOP 1.69: Domain d1a8b__: 1a8b -

Lineage for d1a8b__ (1a8b -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (8 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)

8. Domain d1a8b__: 1a8b - [18171]

Details for d1a8b__

PDB Entry: 1a8b, 1.9 Å

PDB Description: rat annexin v complexed with glycerophosphoethanolamine

SCOP Domain Sequences for d1a8b__:

Sequence; same for both SEQRES and ATOM records:

>d1a8b__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

Timeline for d1a8b__:

• d1a8b__ first appeared (with stable ids) in SCOP 1.55
  
• d1a8b__ appears in SCOP 1.67
  
• d1a8b__ appears in SCOP 1.71
  
• d1a8b__ appears in the current release, SCOPe 2.08, called d1a8ba_