Lineage for d1a8b__ (1a8b -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4582Fold a.65: Annexin [47873] (1 superfamily)
  4. 4583Superfamily a.65.1: Annexin [47874] (1 family) (S)
  5. 4584Family a.65.1.1: Annexin [47875] (7 proteins)
  6. 4604Protein Annexin V [47883] (3 species)
  7. 4623Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (9 PDB entries)
  8. 4626Domain d1a8b__: 1a8b - [18171]

Details for d1a8b__

PDB Entry: 1a8b (more details), 1.9 Å

PDB Description: rat annexin v complexed with glycerophosphoethanolamine

SCOP Domain Sequences for d1a8b__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8b__ a.65.1.1 (-) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOP Domain Coordinates for d1a8b__:

Click to download the PDB-style file with coordinates for d1a8b__.
(The format of our PDB-style files is described here.)

Timeline for d1a8b__: