SCOPe 2.08: Domain d1a8ba_: 1a8b A:

Lineage for d1a8ba_ (1a8b A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)

8. Domain d1a8ba_: 1a8b A: [18171]
   complexed with ca, gpe

Details for d1a8ba_

PDB Entry: 1a8b, 1.9 Å

PDB Description: rat annexin v complexed with glycerophosphoethanolamine

PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1a8ba_:

Sequence; same for both SEQRES and ATOM records:

>d1a8ba_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

Timeline for d1a8ba_:

• d1a8ba_ first appeared (with stable ids) in SCOP 1.55, called d1a8b__
  
• d1a8ba_ appears in SCOPe 2.07