![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
![]() | Superfamily a.65.1: Annexin [47874] (2 families) ![]() duplication: consists of four domains of the same fold |
![]() | Family a.65.1.1: Annexin [47875] (10 proteins) |
![]() | Protein Annexin V [47883] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries) |
![]() | Domain d1a8ba_: 1a8b A: [18171] complexed with ca, gpe |
PDB Entry: 1a8b (more details), 1.9 Å
SCOPe Domain Sequences for d1a8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8ba_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]} alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd tsgdykkallllcggedd
Timeline for d1a8ba_: