Lineage for d3mymb_ (3mym B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075024Protein Dehaloperoxidase [46530] (1 species)
  7. 1075025Species Amphitrite ornata [TaxId:129555] [46531] (20 PDB entries)
  8. 1075043Domain d3mymb_: 3mym B: [181701]
    automated match to d1ew6a_
    complexed with cyn, hem, so4; mutant

Details for d3mymb_

PDB Entry: 3mym (more details), 1.72 Å

PDB Description: Mutation of Methionine-86 in Dehaloperoxidase-hemoglobin: Effects of the Asp-His-Fe Triad in a 3/3 Globin
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3mymb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mymb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqekqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3mymb_:

Click to download the PDB-style file with coordinates for d3mymb_.
(The format of our PDB-style files is described here.)

Timeline for d3mymb_: