Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [159632] (7 PDB entries) Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234 |
Domain d3mxjb_: 3mxj B: [181680] automated match to d2ioca1 |
PDB Entry: 3mxj (more details), 1.95 Å
SCOPe Domain Sequences for d3mxjb_:
Sequence, based on SEQRES records: (download)
>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} qtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprv vdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclva hngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiy trlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg
>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} qtlphghmqtlifldleatglpssrpevtelcllavhrralentsghpppvprpprvvdk lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng drydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdsh taegdvltllsicqwkpqallqwvdeharpfstvkpmyg
Timeline for d3mxjb_: