Lineage for d3mxjb_ (3mxj B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996218Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 996442Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)
  7. 996443Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
    Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234
  8. 996447Domain d3mxjb_: 3mxj B: [181680]
    automated match to d2ioca1

Details for d3mxjb_

PDB Entry: 3mxj (more details), 1.95 Å

PDB Description: Crystal Structure of the mTREX1 Apoprotein
PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3mxjb_:

Sequence, based on SEQRES records: (download)

>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprv
vdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclva
hngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiy
trlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsghpppvprpprvvdk
lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
drydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d3mxjb_:

Click to download the PDB-style file with coordinates for d3mxjb_.
(The format of our PDB-style files is described here.)

Timeline for d3mxjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mxja_