PDB entry 3mxj

View 3mxj on RCSB PDB site
Description: Crystal Structure of the mTREX1 Apoprotein
Class: hydrolase
Keywords: RNase H-like fold, Polyproline II helix, HYDROLASE
Deposited on 2010-05-07, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mxja_
  • Chain 'B':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mxjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mxjA (A:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxjA (A:)
    lphghmqtlifldleatglpssrpevtelcllavhrraleppvprpprvvdklslciapg
    kacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdrydfpll
    qtelarlstpspldgtfcvdsiaalkaleqksyslgsiytrlywqaptdshtaegdvltl
    lsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mxjB (B:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxjB (B:)
    qtlphghmqtlifldleatglpssrpevtelcllavhrralentsghpppvprpprvvdk
    lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
    drydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdsh
    taegdvltllsicqwkpqallqwvdeharpfstvkpmyg