Lineage for d3msga_ (3msg A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970728Protein Xylanase [51488] (6 species)
  7. 970729Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
    intra-cellular xylanase
  8. 970734Domain d3msga_: 3msg A: [181528]
    automated match to d1n82a_
    complexed with act, gol, na, xyp

Details for d3msga_

PDB Entry: 3msg (more details), 1.5 Å

PDB Description: enzyme-substrate interactions of ixt6, the intracellular xylanase of g. stearothermophilus.
PDB Compounds: (A:) Intra-cellular xylanase ixt6

SCOPe Domain Sequences for d3msga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3msga_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv

SCOPe Domain Coordinates for d3msga_:

Click to download the PDB-style file with coordinates for d3msga_.
(The format of our PDB-style files is described here.)

Timeline for d3msga_: