Lineage for d3mmhb_ (3mmh B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038010Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1038094Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 1038095Protein automated matches [190838] (3 species)
    not a true protein
  7. 1038098Species Neisseria meningitidis [TaxId:604162] [189344] (1 PDB entry)
  8. 1038100Domain d3mmhb_: 3mmh B: [181423]
    automated match to d1f5ma_
    complexed with act, mg, mrd, sme

Details for d3mmhb_

PDB Entry: 3mmh (more details), 1.25 Å

PDB Description: X-ray structure of free methionine-R-sulfoxide reductase from neisseria meningitidis in complex with its substrate
PDB Compounds: (B:) Methionine-R-sulfoxide reductase

SCOPe Domain Sequences for d3mmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmhb_ d.110.2.0 (B:) automated matches {Neisseria meningitidis [TaxId: 604162]}
mhalhfsasdkaalyrevlpqiesvvadetdwvanlantaavlkeafgwfwvgfylvdtr
sdelvlapfqgplactripfgrgvcgqawakggtvvvgdvdahpdhiacsslsrseivvp
lfsdgrcigvldadsehlaqfdetdalylgelakilekrfeasrqav

SCOPe Domain Coordinates for d3mmhb_:

Click to download the PDB-style file with coordinates for d3mmhb_.
(The format of our PDB-style files is described here.)

Timeline for d3mmhb_: