![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
![]() | Protein automated matches [190838] (19 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:604162] [189344] (1 PDB entry) |
![]() | Domain d3mmhb_: 3mmh B: [181423] automated match to d1f5ma_ complexed with act, mg, mrd, sme |
PDB Entry: 3mmh (more details), 1.25 Å
SCOPe Domain Sequences for d3mmhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmhb_ d.110.2.0 (B:) automated matches {Neisseria meningitidis [TaxId: 604162]} mhalhfsasdkaalyrevlpqiesvvadetdwvanlantaavlkeafgwfwvgfylvdtr sdelvlapfqgplactripfgrgvcgqawakggtvvvgdvdahpdhiacsslsrseivvp lfsdgrcigvldadsehlaqfdetdalylgelakilekrfeasrqav
Timeline for d3mmhb_: