Lineage for d3mmce1 (3mmc E:197-261)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203940Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1203984Protein DsrB insert domain [160277] (2 species)
  7. 1203985Species Archaeoglobus fulgidus [TaxId:2234] [160279] (1 PDB entry)
    Uniprot Q59110 197-261
  8. 1203987Domain d3mmce1: 3mmc E:197-261 [181415]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce2, d3mmce3
    automatically matched to 3C7B B:197-261
    complexed with gol, sf4, srm

Details for d3mmce1

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmce1 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mmce1:

Click to download the PDB-style file with coordinates for d3mmce1.
(The format of our PDB-style files is described here.)

Timeline for d3mmce1: