| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein DsrB insert domain [160277] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries) Uniprot Q59110 197-261 |
| Domain d3mmce1: 3mmc E:197-261 [181415] Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce2, d3mmce3 automated match to d3mmcb1 complexed with gol, sf4, srm |
PDB Entry: 3mmc (more details), 2.04 Å
SCOPe Domain Sequences for d3mmce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmce1 d.58.1.5 (E:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen
Timeline for d3mmce1: