Lineage for d1aepa_ (1aep A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917704Fold a.63: Apolipophorin-III [47856] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 917705Superfamily a.63.1: Apolipophorin-III [47857] (1 family) (S)
  5. 917706Family a.63.1.1: Apolipophorin-III [47858] (1 protein)
  6. 917707Protein Apolipophorin-III [47859] (2 species)
    five-helical bundle
    probably related to four-helical (apo)lipoproteins
  7. 917708Species African locust (Locusta migratoria) [TaxId:7004] [47860] (2 PDB entries)
  8. 917709Domain d1aepa_: 1aep A: [18139]

Details for d1aepa_

PDB Entry: 1aep (more details), 2.7 Å

PDB Description: molecular structure of an apolipoprotein determined at 2.5-angstroms resolution
PDB Compounds: (A:) apolipophorin III

SCOPe Domain Sequences for d1aepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aepa_ a.63.1.1 (A:) Apolipophorin-III {African locust (Locusta migratoria) [TaxId: 7004]}
niaeavqqlnhtivnaahelhetlglptpdealnllteqanafktkiaevttslkqeaek
hqgsvaeqlnafarnlnnsihdaatslnlqdqlnslqsaltnvghqwqdiatktqasaqe
awapvqsalqeaaektkeaaanlqnsiqsavqk

SCOPe Domain Coordinates for d1aepa_:

Click to download the PDB-style file with coordinates for d1aepa_.
(The format of our PDB-style files is described here.)

Timeline for d1aepa_: