| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.63: Apolipophorin-III [47856] (1 superfamily) 5 helices; bundle, closed, left-handed twist |
Superfamily a.63.1: Apolipophorin-III [47857] (1 family) ![]() |
| Family a.63.1.1: Apolipophorin-III [47858] (1 protein) |
| Protein Apolipophorin-III [47859] (2 species) five-helical bundle probably related to four-helical (apo)lipoproteins |
| Species Migratory locust (Locusta migratoria) [TaxId:7004] [47860] (2 PDB entries) |
| Domain d1aepa_: 1aep A: [18139] |
PDB Entry: 1aep (more details), 2.7 Å
SCOPe Domain Sequences for d1aepa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aepa_ a.63.1.1 (A:) Apolipophorin-III {Migratory locust (Locusta migratoria) [TaxId: 7004]}
niaeavqqlnhtivnaahelhetlglptpdealnllteqanafktkiaevttslkqeaek
hqgsvaeqlnafarnlnnsihdaatslnlqdqlnslqsaltnvghqwqdiatktqasaqe
awapvqsalqeaaektkeaaanlqnsiqsavqk
Timeline for d1aepa_: