SCOPe 2.01: Domain d3mgqe_: 3mgq E:

Lineage for d3mgqe_ (3mgq E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (38 PDB entries)

8. Domain d3mgqe_: 3mgq E: [181199]
   Other proteins in same PDB: d3mgqc_, d3mgqg_
   automated match to d1kx5a_
   protein/DNA complex; complexed with cl, ni

Details for d3mgqe_

PDB Entry: 3mgq, 2.65 Å

PDB Description: binding of nickel ions to the nucleosome core particle

PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3mgqe_:

Sequence; same for both SEQRES and ATOM records:

>d3mgqe_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d3mgqe_:

• d3mgqe_ is new in SCOPe 2.01-stable
  
• d3mgqe_ appears in SCOPe 2.02
  
• d3mgqe_ appears in the current release, SCOPe 2.08