Lineage for d3mgpe_ (3mgp E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909423Protein Histone H3 [47122] (5 species)
  7. 909424Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (38 PDB entries)
  8. 909450Domain d3mgpe_: 3mgp E: [181195]
    Other proteins in same PDB: d3mgpc_, d3mgpg_
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, co

Details for d3mgpe_

PDB Entry: 3mgp (more details), 2.44 Å

PDB Description: binding of cobalt ions to the nucleosome core particle
PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3mgpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgpe_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3mgpe_:

Click to download the PDB-style file with coordinates for d3mgpe_.
(The format of our PDB-style files is described here.)

Timeline for d3mgpe_: