SCOPe 2.06: Domain d1ezba1: 1ezb A:22-144

Lineage for d1ezba1 (1ezb A:22-144)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family)

5. Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)

6. Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
   inserted in the phosphohistidine domain

7. Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)

8. Domain d1ezba1: 1ezb A:22-144 [18117]
   Other proteins in same PDB: d1ezba2

Details for d1ezba1

PDB Entry: 1ezb

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 17 structures

PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1ezba1:

Sequence; same for both SEQRES and ATOM records:

>d1ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

Timeline for d1ezba1:

• d1ezba1 first appeared (with stable ids) in SCOP 1.55, called d1ezb_1
  
• d1ezba1 appears in SCOPe 2.05
  
• d1ezba1 appears in SCOPe 2.07
  
• d1ezba1 appears in the current release, SCOPe 2.08