| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) ![]() |
| Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) |
| Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) inserted in the phosphohistidine domain |
| Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) |
| Domain d1ezba1: 1ezb A:22-144 [18117] Other proteins in same PDB: d1ezba2 |
PDB Entry: 1ezb (more details)
SCOPe Domain Sequences for d1ezba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl
Timeline for d1ezba1: