Lineage for d1zyma1 (1zym A:22-144)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494191Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 1494192Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 1494193Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
    inserted in the phosphohistidine domain
  7. 1494194Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 1494195Domain d1zyma1: 1zym A:22-144 [18110]
    Other proteins in same PDB: d1zyma2, d1zymb2

Details for d1zyma1

PDB Entry: 1zym (more details), 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli
PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1zyma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyma1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOPe Domain Coordinates for d1zyma1:

Click to download the PDB-style file with coordinates for d1zyma1.
(The format of our PDB-style files is described here.)

Timeline for d1zyma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zyma2