SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1zyma1 (1zym A:22-144)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999457Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) (S)
  5. 1999458Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)
  6. 1999459Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
    inserted in the phosphohistidine domain
  7. 1999460Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)
  8. 1999461Domain d1zyma1: 1zym A:22-144 [18110]
    Other proteins in same PDB: d1zyma2, d1zymb2

Details for d1zyma1

PDB Entry: 1zym (more details), 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli
PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1zyma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyma1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

SCOPe Domain Coordinates for d1zyma1:

Click to download the PDB-style file with coordinates for d1zyma1.
(The format of our PDB-style files is described here.)

Timeline for d1zyma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zyma2