Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins) Pfam PF05448; AXE1 |
Protein automated matches [191114] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [189317] (3 PDB entries) |
Domain d3m83f1: 3m83 F:1-324 [180944] Other proteins in same PDB: d3m83a2, d3m83b2, d3m83c2, d3m83d2, d3m83e2, d3m83f2 automated match to d1vlqa_ complexed with act, ca, edo |
PDB Entry: 3m83 (more details), 2.12 Å
SCOPe Domain Sequences for d3m83f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m83f1 c.69.1.25 (F:1-324) automated matches {Thermotoga maritima [TaxId: 2336]} maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthr dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy nnhegggsfqaveqvkflkklfek
Timeline for d3m83f1: