| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() automatically mapped to Pfam PF00600 |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein automated matches [190936] (6 species) not a true protein |
| Species Influenza A virus [TaxId:641809] [189299] (1 PDB entry) |
| Domain d3m5re_: 3m5r E: [180875] Other proteins in same PDB: d3m5ra2, d3m5rb2 automated match to d2gx9a1 |
PDB Entry: 3m5r (more details), 2 Å
SCOPe Domain Sequences for d3m5re_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5re_ d.299.1.1 (E:) automated matches {Influenza A virus [TaxId: 641809]}
svptsrylsdmtleemsrdwfmlmprqkiigplcvrldqaimeknivlkanfsvifnrle
tlillrafteegaivgeisplpslpghtyedvknavgvligglewngntvrvseniqrfa
w
Timeline for d3m5re_: