Lineage for d3m5re_ (3m5r E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053069Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1053070Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
  5. 1053071Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1053076Protein automated matches [190936] (5 species)
    not a true protein
  7. 1053090Species Influenza A virus [TaxId:641809] [189299] (1 PDB entry)
  8. 1053094Domain d3m5re_: 3m5r E: [180875]
    automated match to d2gx9a1

Details for d3m5re_

PDB Entry: 3m5r (more details), 2 Å

PDB Description: crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
PDB Compounds: (E:) nonstructural protein 1

SCOPe Domain Sequences for d3m5re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5re_ d.299.1.1 (E:) automated matches {Influenza A virus [TaxId: 641809]}
svptsrylsdmtleemsrdwfmlmprqkiigplcvrldqaimeknivlkanfsvifnrle
tlillrafteegaivgeisplpslpghtyedvknavgvligglewngntvrvseniqrfa
w

SCOPe Domain Coordinates for d3m5re_:

Click to download the PDB-style file with coordinates for d3m5re_.
(The format of our PDB-style files is described here.)

Timeline for d3m5re_: