| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species) |
| Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries) |
| Domain d1cmwa1: 1cmw A:174-289 [18084] Other proteins in same PDB: d1cmwa2, d1cmwa3, d1cmwa4 |
PDB Entry: 1cmw (more details), 2.6 Å
SCOP Domain Sequences for d1cmwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle
Timeline for d1cmwa1: