Lineage for d1cmwa1 (1cmw A:174-289)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444508Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 444509Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 444510Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 444511Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)
  8. 444513Domain d1cmwa1: 1cmw A:174-289 [18084]
    Other proteins in same PDB: d1cmwa2, d1cmwa3, d1cmwa4

Details for d1cmwa1

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOP Domain Coordinates for d1cmwa1:

Click to download the PDB-style file with coordinates for d1cmwa1.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa1: