Lineage for d1cmwa1 (1cmw A:174-289)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4452Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 4453Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)
  6. 4454Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 4455Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)
  8. 4457Domain d1cmwa1: 1cmw A:174-289 [18084]
    Other proteins in same PDB: d1cmwa2, d1cmwa3, d1cmwa4

Details for d1cmwa1

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOP Domain Coordinates for d1cmwa1:

Click to download the PDB-style file with coordinates for d1cmwa1.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa1: