Lineage for d3m2rc_ (3m2r C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029849Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1029850Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 1029851Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 1029852Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries)
  8. 1029859Domain d3m2rc_: 3m2r C: [180763]
    automated match to d1hbmc_
    complexed with com, edo, f43, mg, peg, tp7, tpz, zn

Details for d3m2rc_

PDB Entry: 3m2r (more details), 1.3 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (C:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d3m2rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2rc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfn

SCOPe Domain Coordinates for d3m2rc_:

Click to download the PDB-style file with coordinates for d3m2rc_.
(The format of our PDB-style files is described here.)

Timeline for d3m2rc_: