| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries) |
| Domain d3m2rc_: 3m2r C: [180763] Other proteins in same PDB: d3m2ra1, d3m2ra2, d3m2rb1, d3m2rb2, d3m2rd1, d3m2rd2, d3m2re1, d3m2re2 automated match to d1hbmc_ complexed with com, edo, f43, mg, peg, tp7, tpz, zn |
PDB Entry: 3m2r (more details), 1.3 Å
SCOPe Domain Sequences for d3m2rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2rc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfn
Timeline for d3m2rc_: