![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) |
![]() | Domain d1bpda1: 1bpd A:9-91 [18073] Other proteins in same PDB: d1bpda2, d1bpda3 complexed with po4 |
PDB Entry: 1bpd (more details), 3.6 Å
SCOPe Domain Sequences for d1bpda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpda1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk iaekideflatgklrklekirqd
Timeline for d1bpda1: