Lineage for d3lzzb_ (3lzz B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424662Species Branchiostoma belcheri [TaxId:155462] [189354] (2 PDB entries)
  8. 2424665Domain d3lzzb_: 3lzz B: [180677]
    automated match to d1yuda1
    complexed with act, gdp

Details for d3lzzb_

PDB Entry: 3lzz (more details), 2.5 Å

PDB Description: Crystal structures of Cupin superfamily BbDUF985 from Branchiostoma belcheri tsingtauense in apo and GDP-bound forms
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lzzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzzb_ b.82.1.0 (B:) automated matches {Branchiostoma belcheri [TaxId: 155462]}
eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh
rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy
clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss

SCOPe Domain Coordinates for d3lzzb_:

Click to download the PDB-style file with coordinates for d3lzzb_.
(The format of our PDB-style files is described here.)

Timeline for d3lzzb_: