Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (31 species) not a true protein |
Species Branchiostoma belcheri [TaxId:155462] [189354] (2 PDB entries) |
Domain d3lzzb_: 3lzz B: [180677] automated match to d1yuda1 complexed with act, gdp |
PDB Entry: 3lzz (more details), 2.5 Å
SCOPe Domain Sequences for d3lzzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzzb_ b.82.1.0 (B:) automated matches {Branchiostoma belcheri [TaxId: 155462]} eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss
Timeline for d3lzzb_: