SCOPe 2.01: Domain d3lzzb_: 3lzz B:

Lineage for d3lzzb_ (3lzz B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (5 species)
   not a true protein

7. Species Branchiostoma belcheri [TaxId:155462] [189354] (2 PDB entries)

8. Domain d3lzzb_: 3lzz B: [180677]
   automated match to d1yuda1
   complexed with act, gdp

Details for d3lzzb_

PDB Entry: 3lzz, 2.5 Å

PDB Description: Crystal structures of Cupin superfamily BbDUF985 from Branchiostoma belcheri tsingtauense in apo and GDP-bound forms

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lzzb_:

Sequence; same for both SEQRES and ATOM records:

>d3lzzb_ b.82.1.0 (B:) automated matches {Branchiostoma belcheri [TaxId: 155462]}
eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh
rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy
clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss

Timeline for d3lzzb_:

• d3lzzb_ is new in SCOPe 2.01-stable
  
• d3lzzb_ appears in SCOPe 2.02
  
• d3lzzb_ appears in the current release, SCOPe 2.08