Lineage for d3lzea_ (3lze A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966409Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins)
  6. 2966427Protein automated matches [191141] (1 species)
    not a true protein
  7. 2966428Species Plasmodium vivax [TaxId:5855] [189269] (3 PDB entries)
  8. 2966431Domain d3lzea_: 3lze A: [180661]
    automated match to d2a0sa1
    complexed with pe0, zn; mutant

Details for d3lzea_

PDB Entry: 3lze (more details), 1.9 Å

PDB Description: plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant
PDB Compounds: (A:) Putative 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d3lzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzea_ d.96.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
dqiaellvesplfsfncahfiafkgfrctlhghnynvslrlrgniqgdgyvidfsilkek
vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni

SCOPe Domain Coordinates for d3lzea_:

Click to download the PDB-style file with coordinates for d3lzea_.
(The format of our PDB-style files is described here.)

Timeline for d3lzea_: