Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins) |
Protein automated matches [191141] (1 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [189269] (3 PDB entries) |
Domain d3lzea_: 3lze A: [180661] automated match to d2a0sa1 complexed with pe0, zn; mutant |
PDB Entry: 3lze (more details), 1.9 Å
SCOPe Domain Sequences for d3lzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzea_ d.96.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} dqiaellvesplfsfncahfiafkgfrctlhghnynvslrlrgniqgdgyvidfsilkek vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
Timeline for d3lzea_: