Lineage for d3lrpa_ (3lrp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868663Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189514] (1 PDB entry)
  8. 2868664Domain d3lrpa_: 3lrp A: [180532]
    automated match to d1hura_
    complexed with gdp, mg, so4

Details for d3lrpa_

PDB Entry: 3lrp (more details), 2.5 Å

PDB Description: Crystal Structure of Plasmodium falciparum ADP-Ribosylation Factor 1
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d3lrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lrpa_ c.37.1.8 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mglyvsrlfnrlfqkkdvrilmvgldaagkttilykvklgevvttiptigfnvetvefrn
isftvwdvggqdkirplwrhyysntdglifvvdsndreriddareelhrmineeelkdai
ilvfankqdlpnamsaaevteklhlntirernwfiqstcatrgdglyegfdwltthlnna
k

SCOPe Domain Coordinates for d3lrpa_:

Click to download the PDB-style file with coordinates for d3lrpa_.
(The format of our PDB-style files is described here.)

Timeline for d3lrpa_: