Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
Protein Hypothetical transcriptional regulator YcdC [89136] (1 species) |
Species Escherichia coli [TaxId:562] [89137] (1 PDB entry) |
Domain d3locd2: 3loc D:86-211 [180472] Other proteins in same PDB: d3loca1, d3locb1, d3locc1, d3locd1 complexed with ura |
PDB Entry: 3loc (more details), 2.5 Å
SCOPe Domain Sequences for d3locd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3locd2 a.121.1.1 (D:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii egirpr
Timeline for d3locd2: