Lineage for d3locd2 (3loc D:86-211)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1096810Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1096811Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 1096812Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 1096827Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 1096828Species Escherichia coli [TaxId:562] [89137] (1 PDB entry)
  8. 1096832Domain d3locd2: 3loc D:86-211 [180472]
    Other proteins in same PDB: d3loca1, d3locb1, d3locc1, d3locd1
    complexed with ura

Details for d3locd2

PDB Entry: 3loc (more details), 2.5 Å

PDB Description: crystal structure of putative transcriptional regulator ycdc
PDB Compounds: (D:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d3locd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3locd2 a.121.1.1 (D:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOPe Domain Coordinates for d3locd2:

Click to download the PDB-style file with coordinates for d3locd2.
(The format of our PDB-style files is described here.)

Timeline for d3locd2: