SCOPe 2.02: Domain d3locb1: 3loc B:11-85

Lineage for d3locb1 (3loc B:11-85)

Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
Species Escherichia coli [TaxId:562] [88974] (1 PDB entry)
Domain d3locb1: 3loc B:11-85 [180467]
Other proteins in same PDB: d3loca2, d3locb2, d3locc2, d3locd2
complexed with ura

Details for d3locb1

PDB Entry: 3loc (more details), 2.5 Å

PDB Description: crystal structure of putative transcriptional regulator ycdc

PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d3locb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3locb1 a.4.1.9 (B:11-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
rsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlr
qildiwlaplkafre

SCOPe Domain Coordinates for d3locb1:

Click to download the PDB-style file with coordinates for d3locb1.
(The format of our PDB-style files is described here.)

Timeline for d3locb1: