SCOPe 2.07: Domain d3locc2: 3loc C:86-211

Lineage for d3locc2 (3loc C:86-211)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)

7. Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)

8. Domain d3locc2: 3loc C:86-211 [180470]
   Other proteins in same PDB: d3loca1, d3locb1, d3locc1, d3locd1
   complexed with ura

Details for d3locc2

PDB Entry: 3loc, 2.5 Å

PDB Description: crystal structure of putative transcriptional regulator ycdc

PDB Compounds: (C:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d3locc2:

Sequence; same for both SEQRES and ATOM records:

>d3locc2 a.121.1.1 (C:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

Timeline for d3locc2:

• d3locc2 first appeared in SCOPe 2.01
  
• d3locc2 appears in SCOPe 2.06
  
• d3locc2 appears in the current release, SCOPe 2.08