Lineage for d3loca2 (3loc A:86-211)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2340993Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 2340994Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)
  8. 2341005Domain d3loca2: 3loc A:86-211 [180466]
    Other proteins in same PDB: d3loca1, d3locb1, d3locc1, d3locd1
    complexed with ura

Details for d3loca2

PDB Entry: 3loc (more details), 2.5 Å

PDB Description: crystal structure of putative transcriptional regulator ycdc
PDB Compounds: (A:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d3loca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3loca2 a.121.1.1 (A:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOPe Domain Coordinates for d3loca2:

Click to download the PDB-style file with coordinates for d3loca2.
(The format of our PDB-style files is described here.)

Timeline for d3loca2: