Lineage for d3lnta1 (3lnt A:1-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2891019Protein automated matches [190196] (7 species)
    not a true protein
  7. 2891029Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries)
  8. 2891032Domain d3lnta1: 3lnt A:1-244 [180424]
    Other proteins in same PDB: d3lnta2
    automated match to d1e59a_
    complexed with edo, mli, na

Details for d3lnta1

PDB Entry: 3lnt (more details), 2.1 Å

PDB Description: Crystal structure of phosphoglyceromutase from Burkholderia Pseudomallei 1710B with bound malonic acid
PDB Compounds: (A:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3lnta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnta1 c.60.1.1 (A:1-244) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgdqeaiakaqaa
vaqq

SCOPe Domain Coordinates for d3lnta1:

Click to download the PDB-style file with coordinates for d3lnta1.
(The format of our PDB-style files is described here.)

Timeline for d3lnta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnta2
View in 3D
Domains from other chains:
(mouse over for more information)
d3lntb_