Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
Protein automated matches [190196] (7 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries) |
Domain d3lnta1: 3lnt A:1-244 [180424] Other proteins in same PDB: d3lnta2 automated match to d1e59a_ complexed with edo, mli, na |
PDB Entry: 3lnt (more details), 2.1 Å
SCOPe Domain Sequences for d3lnta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnta1 c.60.1.1 (A:1-244) automated matches {Burkholderia pseudomallei [TaxId: 320372]} myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgdqeaiakaqaa vaqq
Timeline for d3lnta1: