Lineage for d3lnob1 (3lno B:1-105)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554329Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2554361Family d.52.8.0: automated matches [191619] (1 protein)
    not a true family
  6. 2554362Protein automated matches [191134] (3 species)
    not a true protein
  7. 2554363Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry)
  8. 2554365Domain d3lnob1: 3lno B:1-105 [180418]
    Other proteins in same PDB: d3lnoa2, d3lnob2, d3lnoc2, d3lnod2, d3lnoe2, d3lnof2
    automated match to d1uwda_

Details for d3lnob1

PDB Entry: 3lno (more details), 2.1 Å

PDB Description: Crystal Structure of Domain of Unknown Function DUF59 from Bacillus anthracis
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lnob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnob1 d.52.8.0 (B:1-105) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
msqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmagqi
vsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird

SCOPe Domain Coordinates for d3lnob1:

Click to download the PDB-style file with coordinates for d3lnob1.
(The format of our PDB-style files is described here.)

Timeline for d3lnob1: