Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.0: automated matches [191619] (1 protein) not a true family |
Protein automated matches [191134] (3 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry) |
Domain d3lnoa1: 3lno A:1-104 [180417] Other proteins in same PDB: d3lnoa2, d3lnob2, d3lnoc2, d3lnod2, d3lnoe2, d3lnof2 automated match to d1uwda_ |
PDB Entry: 3lno (more details), 2.1 Å
SCOPe Domain Sequences for d3lnoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnoa1 d.52.8.0 (A:1-104) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} msqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmagqi vsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir
Timeline for d3lnoa1: