Lineage for d3llrd_ (3llr D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394399Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2394400Protein automated matches [191144] (3 species)
    not a true protein
  7. 2394415Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2394478Domain d3llrd_: 3llr D: [180377]
    automated match to d1khca_
    complexed with btb, so4

Details for d3llrd_

PDB Entry: 3llr (more details), 2.3 Å

PDB Description: crystal structure of the pwwp domain of human dna (cytosine-5-)- methyltransferase 3 alpha
PDB Compounds: (D:) DNA (cytosine-5)-methyltransferase 3A

SCOPe Domain Sequences for d3llrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3llrd_ b.34.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcve
klmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpvchdsdesdtakavevq
nkpmiewalggfqpsgpkglepp

SCOPe Domain Coordinates for d3llrd_:

Click to download the PDB-style file with coordinates for d3llrd_.
(The format of our PDB-style files is described here.)

Timeline for d3llrd_: