SCOPe 2.07: Domain d3llrc_: 3llr C:

Lineage for d3llrc_ (3llr C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)

8. Domain d3llrc_: 3llr C: [180376]
   automated match to d1khca_
   complexed with btb, so4

Details for d3llrc_

PDB Entry: 3llr, 2.3 Å

PDB Description: crystal structure of the pwwp domain of human dna (cytosine-5-)- methyltransferase 3 alpha

PDB Compounds: (C:) DNA (cytosine-5)-methyltransferase 3A

SCOPe Domain Sequences for d3llrc_:

Sequence, based on SEQRES records:

>d3llrc_ b.34.9.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcve
klmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpvchdsdesdtakavevq
nkpmiewalggfqpsgpkglepp

Sequence, based on observed residues (ATOM records):

>d3llrc_ b.34.9.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcve
klmplssfcsafhqatynkqpmyrkaiyevlqvassragklfkavevqnkpmiewalggf
qpsgpkglepp

Timeline for d3llrc_:

• d3llrc_ first appeared in SCOPe 2.01
  
• d3llrc_ appears in SCOPe 2.06
  
• d3llrc_ appears in the current release, SCOPe 2.08