Lineage for d3ljae_ (3lja E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262431Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1262626Protein Histone H3 [47122] (6 species)
  7. 1262627Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1262655Domain d3ljae_: 3lja E: [180319]
    Other proteins in same PDB: d3ljab_, d3ljad_, d3ljaf_, d3ljah_
    automated match to d1kx5a_
    protein/DNA complex; complexed with mn, so4

Details for d3ljae_

PDB Entry: 3lja (more details), 2.75 Å

PDB Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome
PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3ljae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljae_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3ljae_:

Click to download the PDB-style file with coordinates for d3ljae_.
(The format of our PDB-style files is described here.)

Timeline for d3ljae_: