SCOPe 2.03: Domain d3ljad_: 3lja D:

Lineage for d3ljad_ (3lja D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries)

8. Domain d3ljad_: 3lja D: [191767]
   Other proteins in same PDB: d3ljaa_, d3ljab_, d3ljae_, d3ljaf_
   automated match to d1kx5d_
   protein/DNA complex; complexed with mn, so4

Details for d3ljad_

PDB Entry: 3lja, 2.75 Å

PDB Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome

PDB Compounds: (D:) Histone H2B 1.1

SCOPe Domain Sequences for d3ljad_:

Sequence; same for both SEQRES and ATOM records:

>d3ljad_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d3ljad_:

• d3ljad_ first appeared in SCOPe 2.02
  
• d3ljad_ appears in SCOPe 2.04
  
• d3ljad_ appears in the current release, SCOPe 2.08