SCOPe 2.08: Domain d3lfha_: 3lfh A:

Lineage for d3lfha_ (3lfh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (8 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:273068] [189555] (1 PDB entry)

8. Domain d3lfha_: 3lfh A: [180254]
   Other proteins in same PDB: d3lfhb2, d3lfhe2
   automated match to d1pdoa_

Details for d3lfha_

PDB Entry: 3lfh, 1.8 Å

PDB Description: Crystal structure of manxA from Thermoanaerobacter tengcongensis

PDB Compounds: (A:) Phosphotransferase system, mannose/fructose-specific component IIA

SCOPe Domain Sequences for d3lfha_:

Sequence; same for both SEQRES and ATOM records:

>d3lfha_ c.54.1.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkekfvliithgdfgkgllsgaeviigkqenvhtvglnlgdnievvrkevekiikeklqe
dkeiiivvdlfggspfnialsmmkeydvkvitginmpmlvelltsinvydttellenisk
igkdgikvi

Timeline for d3lfha_:

• d3lfha_ first appeared in SCOPe 2.01
  
• d3lfha_ appears in SCOPe 2.07