| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
| Protein automated matches [190395] (8 species) not a true protein |
| Species Thermoanaerobacter tengcongensis [TaxId:273068] [189555] (1 PDB entry) |
| Domain d3lfhc_: 3lfh C: [180256] Other proteins in same PDB: d3lfhb2, d3lfhe2 automated match to d1pdoa_ |
PDB Entry: 3lfh (more details), 1.8 Å
SCOPe Domain Sequences for d3lfhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lfhc_ c.54.1.0 (C:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkekfvliithgdfgkgllsgaeviigkqenvhtvglnlgdnievvrkevekiikeklqe
dkeiiivvdlfggspfnialsmmkeydvkvitginmpmlvelltsinvydttellenisk
igkdgikviekssl
Timeline for d3lfhc_: