Lineage for d3lfhf_ (3lfh F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883312Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883313Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2883344Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2883345Protein automated matches [190395] (8 species)
    not a true protein
  7. 2883376Species Thermoanaerobacter tengcongensis [TaxId:273068] [189555] (1 PDB entry)
  8. 2883382Domain d3lfhf_: 3lfh F: [180259]
    Other proteins in same PDB: d3lfhb2, d3lfhe2
    automated match to d1pdoa_

Details for d3lfhf_

PDB Entry: 3lfh (more details), 1.8 Å

PDB Description: Crystal structure of manxA from Thermoanaerobacter tengcongensis
PDB Compounds: (F:) Phosphotransferase system, mannose/fructose-specific component IIA

SCOPe Domain Sequences for d3lfhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lfhf_ c.54.1.0 (F:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
ekfvliithgdfgkgllsgaeviigkqenvhtvglnlgdnievvrkevekiikeklqedk
eiiivvdlfggspfnialsmmkeydvkvitginmpmlvelltsinvydttelleniskig
kdgikviek

SCOPe Domain Coordinates for d3lfhf_:

Click to download the PDB-style file with coordinates for d3lfhf_.
(The format of our PDB-style files is described here.)

Timeline for d3lfhf_: